PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4003s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24504.1 Da    PI: 9.737
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4003s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.45e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien + rqvtfskRrng+lKKA+ELSvLCda+v++iifs++g+lye+ss
  Cagra.4003s0006.1.p  9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQVSLIIFSQRGRLYEFSS 59
                         68***********************************************96 PP

2K-box683.1e-2378170597
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          ++++ +e   ++l+qe++ L  +i+ L+  +R+llG+++ s+sl+eLq++ +qL++sl k+R++K +l+ eq+e+l+ kek+l +en +L
  Cagra.4003s0006.1.p  78 TSNHDSEIYLQQLKQEASHLITKIDHLEFHKRRLLGQGIASCSLEELQEIDSQLQRSLGKVRERKAQLFSEQVEKLKAKEKQLLDENVKL 167
                          3444677889******************999*********************************************************** PP

                K-box  95 rkk 97 
                          ++k
  Cagra.4003s0006.1.p 168 HQK 170
                          *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.394161IPR002100Transcription factor, MADS-box
SMARTSM004328.7E-41160IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-33383IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002652.06E-43378No hitNo description
PfamPF003198.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.03987177IPR002487Transcription factor, K-box
PfamPF014864.3E-2387170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQVSLIIFSQ RGRLYEFSSS  60
DMKKTIERYR KYTKDHETSN HDSEIYLQQL KQEASHLITK IDHLEFHKRR LLGQGIASCS  120
LEELQEIDSQ LQRSLGKVRE RKAQLFSEQV EKLKAKEKQL LDENVKLHQK SVIETWRGSN  180
EQQEKCRVID LNLDVQTDLF IGLPNRHCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-22182183Myocyte-specific enhancer factor 2B
1tqe_R4e-22182183Myocyte-specific enhancer factor 2B
1tqe_Q4e-22182183Myocyte-specific enhancer factor 2B
1tqe_P4e-22182183Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0542200.0AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
GenBankAY0652060.0AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds.
GenBankAY0660350.0AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds.
GenBankAY0965090.0AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds.
GenBankAY1412130.0AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281113.11e-148hypothetical protein CARUB_v10027142mg
SwissprotQ9FIS11e-136AGL42_ARATH; MADS-box protein AGL42
TrEMBLR0EYN71e-148R0EYN7_9BRAS; Uncharacterized protein
STRINGAT5G62165.11e-133(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.31e-137AGAMOUS-like 42